PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_25128
Common NameKK1_025550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 323aa    MW: 36472.4 Da    PI: 6.4204
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_25128genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-172067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ l+++++ +G g+W+t a   g++Rt+k+c++rw++yl
    C.cajan_25128 20 RGPWTVDEDLALINYIATHGEGRWNTLALSAGLKRTGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding50.54.8e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    C.cajan_25128  73 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.631567IPR017930Myb domain
SuperFamilySSF466897.11E-3117114IPR009057Homeodomain-like
SMARTSM007172.9E-141969IPR001005SANT/Myb domain
PfamPF002491.6E-152067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-212174IPR009057Homeodomain-like
CDDcd001675.46E-112267No hitNo description
PROSITE profilePS5129422.91768122IPR017930Myb domain
SMARTSM007172.9E-1472120IPR001005SANT/Myb domain
PfamPF002498.0E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2275121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MDEKGSNALS LSEDEMDLRR GPWTVDEDLA LINYIATHGE GRWNTLALSA GLKRTGKSCR  60
LRWLNYLRPD VRRGNITLEE QLLILELHSR WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
HAKQLKCDVN SKQFKDTMRY LWMPRLVERI QAASAASTTA TIVANAPTAT VAATATTNNA  180
YTHGNNNFEV HNHNHKMGLS PSEYVGSQHV TTQSYTPENS NTAASSSDSF GTQVSTISDI  240
TDYYSVPVSG NKNNNCADYY QPSQISYSDC ITSPSGLFPH QGLDFQAVEP NNPWNMQSGD  300
SSDNFWNVEN MLFLEQQLMN DNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-251711424120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0937111e-173BT093711.1 Soybean clone JCVI-FLGm-17N7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001239915.11e-164uncharacterized protein LOC100791349
SwissprotQ9LDE12e-89MY108_ARATH; Transcription factor MYB108
TrEMBLA0A151SCT90.0A0A151SCT9_CAJCA; Myb-related protein 305 family
STRINGGLYMA07G36430.21e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.15e-86myb domain protein 108